PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB04G22330.1
Common NameLOC102708986
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 240aa    MW: 27660.4 Da    PI: 9.2895
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB04G22330.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF892.6e-281059251
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  ri+n++ rqvtfskRrngi+KKA+EL +LCdaev ++ifsstg+lyey+s
  OB04G22330.1 10 RIDNSTSRQVTFSKRRNGIFKKAKELAILCDAEVGLVIFSSTGRLYEYAS 59
                  8***********************************************86 PP

2K-box91.41.6e-3074170298
         K-box   2 qkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                   ++++++++ +++ + +q+e+a L+++++nLq+++R+l+G+dL+ L +keLq Le+qLe s++ iR+kK++l++++i+el +k   +++en++L +k+
  OB04G22330.1  74 DEQQHVANPNSELKFWQREAASLRQQLHNLQENHRQLMGQDLSGLGVKELQTLENQLEMSVRCIRTKKDQLMIDEIHELNRKGSLIHQENMELYRKV 170
                   567777789999**********************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.805161IPR002100Transcription factor, MADS-box
SMARTSM004321.7E-39160IPR002100Transcription factor, MADS-box
CDDcd002651.31E-44277No hitNo description
SuperFamilySSF554554.58E-33291IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-28323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-283859IPR002100Transcription factor, MADS-box
PfamPF014865.3E-2983170IPR002487Transcription factor, K-box
PROSITE profilePS5129715.79186176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGIFK KAKELAILCD AEVGLVIFSS TGRLYEYAST  60
SMKSVIDRYG RAKDEQQHVA NPNSELKFWQ REAASLRQQL HNLQENHRQL MGQDLSGLGV  120
KELQTLENQL EMSVRCIRTK KDQLMIDEIH ELNRKGSLIH QENMELYRKV NLIRQENAEL  180
YKKLYETGAE TEVNQDSTTP YNFAVIEDAN TPVRLELNPP RQQNEAEKSA PPKLGLQLHP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P8e-20169169Myocyte-specific enhancer factor 2B
1tqe_Q8e-20169169Myocyte-specific enhancer factor 2B
1tqe_R8e-20169169Myocyte-specific enhancer factor 2B
1tqe_S8e-20169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2436690.0AK243669.1 Oryza sativa Japonica Group cDNA, clone: J100089N11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006652364.11e-180PREDICTED: MADS-box transcription factor 27-like
SwissprotQ6EP491e-149MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLJ3LYK81e-180J3LYK8_ORYBR; Uncharacterized protein
STRINGOB04G22330.11e-179(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61435130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.13e-99AGAMOUS-like 21